SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X061 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X061
Domain Number 1 Region: 280-523
Classification Level Classification E-value
Superfamily SIS domain 3.34e-17
Family mono-SIS domain 0.0062
Further Details:      
 
Weak hits

Sequence:  H0X061
Domain Number - Region: 29-180
Classification Level Classification E-value
Superfamily SIS domain 0.000445
Family mono-SIS domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0X061
Sequence length 524
Comment (tr|H0X061|H0X061_OTOGA) Glucokinase regulator {ECO:0000313|Ensembl:ENSOGAP00000008281} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GCKR OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAEKIVQLLGQCDAEI
FQEEGQAMPTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FSFLLLGVTPPPIKTELRTGLARSVVASREGTEDSALHGIEELKKVAAGKKKVIVIGISV
GLSPPFQGGACGLVSGRPSHIPRVVGAFLPGAQRRNDPIEDWSSTFRQVAERMQKMQENQ
KAFVLNPAVGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIAASQRCLLEILRTFE
RAHQVTYSQSLKIATLMKQVSTSLEKKGRAYLVGWQTLGIIAIMDGVECIHTFGADFRDI
RGFLIGDHSDMFNQKAELTNQGPQFSFSQEDFLTSILPTLTEVDTVVFIFTLDDNLTEVQ
TLVEQVKEKTTNIQALAHGTVGQSLPAPLKKHFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQ
Download sequence
Identical sequences H0X061
ENSOGAP00000008281 ENSOGAP00000008281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]