SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X074 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X074
Domain Number 1 Region: 96-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000165
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X074
Sequence length 533
Comment (tr|H0X074|H0X074_OTOGA) Transmembrane protein 266 {ECO:0000313|Ensembl:ENSOGAP00000008298} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TMEM266 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
LSHQTTMTAATKGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLL
SNLDEDYQREGSNWLKPCCGQRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKL
LQFSSAFQFAGVIHWISLVILSVFFSETILRIVVLGIWDYIENKIEVFDGAVIILSLAPM
VASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKVEMEMVIQQYEKAKVIQDEQL
ERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRGRYKVVEAGTWDEE
TAAESVVEELRPSEEASVTDDMNSYISQYYNGPSSDSGVPEPAVCVVTTAAIDIHQPNVS
SDLFSLDIPLKLGGSGISASATSESASRFTRSSVTRAQSDSSQTLGSPTDCSTARGEHSS
EPGPSPLPLLPPPQQQMAETTVQDLLSSLSEDPYPPQKALDPAPLTRPSPAGSPQTSPEL
EHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPTLEEKFRSLESKEQKLHRVPEA
Download sequence
Identical sequences H0X074
ENSOGAP00000008298 ENSOGAP00000008298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]