SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X0R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X0R3
Domain Number 1 Region: 261-510
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.37e-83
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 165-266
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.068
Further Details:      
 
Domain Number 3 Region: 128-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  H0X0R3
Domain Number - Region: 27-73
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0366
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X0R3
Sequence length 513
Comment (tr|H0X0R3|H0X0R3_OTOGA) Transmembrane protease, serine 2 {ECO:0000313|Ensembl:ENSOGAP00000008522} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TMPRSS2 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
GHLEHSKYLPLLDAVDKFRMALNSGSPPGAGPYYENQGYQPENLYSSQPAMAPNPYAVYP
AQYYPSTVPQYAPRVVTSASTPTVNVRPKSLGGTTCSSKTKKALYITAALGTILVGGVLA
IVLLWKFIENKCVDSQMECGSSGTCISPYHWCDGISHCPHGEDENRCVRLYGPNFILQVY
SSQRKSWHPVCEDDWSESYGRVACKDLGYKNSFYSSQGITDDTGASDFMKLNKSAGNIEL
YKKLYHSNTCSSKKVVSLRCIACGATWNTSSHSRIVGGSGANLGDWPWQVSLHVQNFHVC
GGSIITPEWIVTAAHCVEEPLNNPRHWTAFAGILRQSFMFYGSGNRVEKVIPHPNYDSKT
KNNDIALMKLRTPLTFNETDKVRPVCLPNLGLMLQPEQPCWISGWGSTKDKGKTSDVLNA
ALVYLIEPWKCNSKYVYNNLITPAMVCAGYLQGTVDSCQGDSGGPLVTLKNGVWWLVGDT
SWGSGCAKPNRPGVYGNVTVFADWIYRQMRVTF
Download sequence
Identical sequences H0X0R3
ENSOGAP00000008522 ENSOGAP00000008522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]