SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X0U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X0U5
Domain Number 1 Region: 191-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-80
Family Protein kinases, catalytic subunit 0.00000181
Further Details:      
 
Domain Number 2 Region: 34-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.2e-30
Family Regulator of G-protein signaling, RGS 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0X0U5
Sequence length 553
Comment (tr|H0X0U5|H0X0U5_OTOGA) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GRK7 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MVDMGGLDNLIANTAYLQARKPSDGDSKELQRRRRSLALPGRQGCAELRRALSPHFHSLC
EQQPIGRRLFRDFLATVPTYREAVAFLEDVQSWELAEEGSAKDSALQGLVAACAPGPAPG
HPHPFLSPALATRCQAATTEDERAAVVALAKAEAMAFLQEQPFRDFLASPFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEK
EILEKVNSPFIVSLAYAFENKSHLCLVMSLMNGGDLKFHIYSVGTRGLPMSRVVFYAAQM
ACGVLHLHTLGIIYRDLKPENVLLDDLGNCRLSDMGLAVQIQDGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKISKEDLKQRTLKEEVRFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHPFFNTINFARLEAGLIEPPFVPDPSVVYA
KDIAEIEDFSEVRGVEFDDKDKKFFQRFATGAVPIAWQEEIIETGLFEELNDPNRPRGCG
EGTSSKSSVCLLL
Download sequence
Identical sequences H0X0U5
ENSOGAP00000008566 XP_003789496.1.62490 ENSOGAP00000008566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]