SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X112 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X112
Domain Number 1 Region: 16-363
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-68
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 421-527,646-677
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.78e-34
Family Phosphate binding protein-like 0.000000688
Further Details:      
 
Weak hits

Sequence:  H0X112
Domain Number - Region: 537-641
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000549
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X112
Sequence length 677
Comment (tr|H0X112|H0X112_OTOGA) Glutamate ionotropic receptor kainate type subunit 1 {ECO:0000313|Ensembl:ENSOGAP00000008648} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GRIK1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYTAISR
AILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGRITFNKTNGLRKDFDLDIISLKEEG
TEKKTKAAGEVSKHLYKVWKKQVLGIKNSWIGKGPSDSFKKHKFNNLVLIFSHSTLLFSN
ISEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEW
NGMVKELIDHKADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNP
LSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGA
LMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQT
KIEYGAVRDGSTMTFFK
Download sequence
Identical sequences H0X112
ENSOGAP00000008648 ENSOGAP00000008648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]