SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X121 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X121
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X121
Sequence length 331
Comment (tr|H0X121|H0X121_OTOGA) Neurogenic differentiation factor {ECO:0000256|PIRNR:PIRNR015618} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=NEUROD4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAKAYVKSKEMVELVNTPSWMEKGLGSQNEMKEEERRPGAYGLLGSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLQEKHDEKSPICDSTISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
PPDCGTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYTFMPHYPSASLNSGHVHSAPFQA
GTPRYDVPIDMSYDSYPHHGIGSQLNTIFTE
Download sequence
Identical sequences H0X121
ENSOGAP00000008657 ENSOGAP00000008657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]