SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X139 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X139
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-74
Family F-box associated region, FBA 0.000002
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X139
Sequence length 255
Comment (tr|H0X139|H0X139_OTOGA) F-box protein 44 {ECO:0000313|Ensembl:ENSOGAP00000008681} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO44 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAVGNINELPESILLELFTHVPARQLLLRCRLVCSLWRDLIDLVSLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPSE
KVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARRDCGSKYQLCVQL
LSSAHAPLGTFQPDPVTIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PKVTNSSITIGPPLR
Download sequence
Identical sequences H0X139
ENSOGAP00000008681 XP_003793323.1.62490 XP_012662786.1.62490 XP_012662787.1.62490 ENSOGAP00000008681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]