SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X1K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X1K4
Domain Number 1 Region: 288-417
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-43
Family Regulator of G-protein signaling, RGS 0.000022
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.03e-28
Family DEP domain 0.011
Further Details:      
 
Domain Number 3 Region: 215-277
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.7e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X1K4
Sequence length 444
Comment (tr|H0X1K4|H0X1K4_OTOGA) Regulator of G protein signaling 7 {ECO:0000313|Ensembl:ENSOGAP00000008877} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=RGS7 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFP
ISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESL
ARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVD
IKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELHQQIKYWQIQLDRHR
LKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFG
MDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGA
PSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKK
GRNLPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences H0X1K4
ENSOGAP00000008877 ENSOGAP00000008877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]