SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X1P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X1P0
Domain Number 1 Region: 147-229
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.09e-16
Family Platelet-derived growth factor-like 0.021
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000432
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Weak hits

Sequence:  H0X1P0
Domain Number - Region: 117-158
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0335
Family Serine carboxypeptidase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X1P0
Sequence length 247
Comment (tr|H0X1P0|H0X1P0_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000008921} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
RYDFVEVEDISETSTVIRGWWCGHKEVLPRITSRTNQIKITFKSDDYFVSKPGFKIYYSF
VEDFQPAAASETNWESVTSSISGVSYHSPSVTDPTLTADALDKTIAEFDTVEDLLKHFNP
ESWQEDLENLYLDTPRYRGRSYHDQKSKVDLDRLNEDVRRYSCTPRNYSVNLREELKLTS
VVFFPRCLLVQRCGGNCGCGTANWKSCTCNSGKTVKKYHEVLKFEPGHFRRRGRAKTMAL
VDIQLDH
Download sequence
Identical sequences H0X1P0
ENSOGAP00000008921 ENSOGAP00000008921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]