SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X2W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X2W7
Domain Number 1 Region: 20-395
Classification Level Classification E-value
Superfamily RNI-like 5.76e-56
Family Cyclin A/CDK2-associated p19, Skp2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0X2W7
Sequence length 423
Comment (tr|H0X2W7|H0X2W7_OTOGA) F-box and leucine rich repeat protein 20 {ECO:0000313|Ensembl:ENSOGAP00000009425} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXL20 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
QMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDF
QRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDA
TCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVKG
CGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDDGLITICRGCHKLQSLC
ASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQIT
DSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLE
HLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCC
IIL
Download sequence
Identical sequences H0X2W7
ENSOGAP00000009425 ENSOGAP00000009425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]