SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0X4A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X4A3
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-57
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 4.19e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0X4A3
Sequence length 585
Comment (tr|H0X4A3|H0X4A3_OTOGA) Potassium voltage-gated channel subfamily C member 1 {ECO:0000313|Ensembl:ENSOGAP00000010015} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KCNC1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTR
ERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT
Download sequence
Identical sequences A0A2K5RPN7 G1S7P7 H0X4A3 H2NDZ7 H2Q386
ENSNLEP00000021536 ENSP00000265969 ENSNLEP00000021536 NP_001106212.1.87134 NP_001106212.1.92137 XP_001172719.3.37143 XP_003254331.1.23891 XP_003781198.1.62490 XP_017381313.1.71028 ENSP00000265969 ENSPPYP00000003960 ENSOGAP00000010015 ENSPTRP00000005944 ENSPPYP00000003960 gi|163792201|ref|NP_001106212.1| ENSPTRP00000005944 ENSOGAP00000010015 ENSP00000265969 9606.ENSP00000265969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]