SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X4D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X4D3
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000014
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 731-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000709
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000737
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  H0X4D3
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000392
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 872-898
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00341
Family PMP inhibitors 0.0043
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.055
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X4D3
Sequence length 1218
Comment (tr|H0X4D3|H0X4D3_OTOGA) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=JAG1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MRSPRTRGRPGCPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRSNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTAQPDNIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCVEGWMGPECNKAICRQGCSL
KHGSCKLPGDCRCQYGWRGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETALGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CLNARGCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDVDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESSPCKNGGTCIDGVNSYKCICSDGWE
GAYCESNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPSPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPLGHSGAKCQEVSGRPCITMGSVIPDGAKWDEDCNTCQCVNGRIACSKVWCGPR
PCLLRKGHSDCPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRHPPKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPSSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
SKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences H0X4D3
XP_003788060.1.62490 ENSOGAP00000010051 ENSOGAP00000010051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]