SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X4M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X4M3
Domain Number 1 Region: 13-220
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-22
Family Nuclease 0.028
Further Details:      
 
Domain Number 2 Region: 318-364,414-476
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000538
Family TrmB middle domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0X4M3
Sequence length 509
Comment (tr|H0X4M3|H0X4M3_OTOGA) Phosphatidylglycerophosphate synthase 1 {ECO:0000313|Ensembl:ENSOGAP00000010157} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PGS1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
RSPWLLLAPLLSPTIPLVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVRVISSPAEFF
ELMKGQIKVAKRRIVMASLYLGTGPLEQELVDCLESTLEKSLEAKFPSDLKVSILLDFTR
GSRGRKNSRTMLLPLLQRFPEQVRVSLFHTPNLRGLLRLLVPERFNETIGLQHIKVYLFD
NNVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTDLVEAVGDVSLQLQRDDTVQVVDG
MVHPYKGDRAAYCKAANKRVMDVINSARTRQQMLHAQTFHSDSLLTQEDAAAAGDRRPAP
DTWIYPLIQMKPFEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYVDLVLGTRAEYQ
ILLASPEVNGFFGAKGVAGAIPAAYVHIERQFYSKVCSLGQQERVQLQEYWRRGWTFHAK
GLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTENRALQQQLHQEQEQLYLRSG
VVSSSTFEQPSRQVKLWVKIVTPLIKNFF
Download sequence
Identical sequences H0X4M3
ENSOGAP00000010157 ENSOGAP00000010157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]