SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X742
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily POZ domain 8.24e-29
Family Tetramerization domain of potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X742
Sequence length 259
Comment (tr|H0X742|H0X742_OTOGA) Potassium channel tetramerization domain containing 4 {ECO:0000313|Ensembl:ENSOGAP00000011212} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KCTD4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLE
GIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLK
GLAEEVKSRWEKEQLAPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRL
DGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLT
SLDCSKGSIVHSDALHFIK
Download sequence
Identical sequences H0X742
ENSOGAP00000011212 ENSOGAP00000011212 XP_003790403.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]