SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X8M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X8M1
Domain Number 1 Region: 742-933
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-46
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 373-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000673
Family SPRY domain 0.0057
Further Details:      
 
Domain Number 3 Region: 126-187
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000595
Family B-box zinc-binding domain 0.00071
Further Details:      
 
Domain Number 4 Region: 595-634
Classification Level Classification E-value
Superfamily F-box domain 0.0000144
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0X8M1
Sequence length 936
Comment (tr|H0X8M1|H0X8M1_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000011850} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
AKRQRKDRLGGRAFQMAELDLMAPGPLLGAAAHPLAPLSPGSGPVSPAEEEDVGSPERPC
REAEGQDSGSAEQGAPGGQDEDILCDFCLGTSRVRAVKSCLTCLVNYCEEHLRPHQENSK
LHSHQLTEPVRDRDLRTCPTHRRPLVTFCCRDQQSICQQCGQEEHRGHTTVSLEAARRDK
EAELRCTQLDLERKLKLNENAIARLQANHKSVLVSVSEVKVVAEEQFGELLAAVRKAQAD
VMLFLEEKEQAALSQANGIKAHLEYRSAEMQKSRQELERVAAIGNTVLFLEEYCKVKSTE
DSNAFPSVYIGLKDKLSGIRKVIVDSTVHLIQQLENYKGRLQEFAKEEEYDIRTQVSAVQ
RKYRTSKPEPRTREQFLQYAHDITFDPDTAHRYLRLQEDNRKVTNTTPWEHPYPDLPSRF
MHWRQVLSQQSLFLHRYYFEGPSPSTILVTFFCLLSLPACLPAFLPSLPPSAPFQAPPVQ
PHLKEGRKRLKKDSSDVYFSPERKYNPQSETSDVYWAVRTQQTSFPLSKAPEGENVQGKA
SDLEGQWRSSLQCISEMNKLFSGEAGLSKLGYDPCNLLIDLDTVKELSSGFSKYRDFIRL
LPIHLSKYILRMLDKNSLHKCFFVSQHWAIVAQQVKMELSAQNFIQNQITILQGSYSKGI
DPTYANKLLIPVPKVVDDSKRGRVKGQRWKLRTKNDYNLWTAYQNQETQQVLMEERNVFC
GTYNVRTLSDTWDKNRVIYYAGGDLVAVSSNRKIHLLDIQKVKALPIVFRGHAGSVRALF
LQEEENFLVSGSYDLSIRYWDLKNGNCIRIFNGHQGTITCIDLYKNKLVSGARDCQVKEW
DLDTGKCLKTFKHKDPILATRINDTYIVSSCERGIVKVWHVAMAQLVKTLSGHEGPVKCL
FFDQWHLLSGSSDGLVMAWSMVGKYERCLMAFKHPK
Download sequence
Identical sequences H0X8M1
ENSOGAP00000011850 ENSOGAP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]