SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0X9R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0X9R0
Domain Number 1 Region: 181-345
Classification Level Classification E-value
Superfamily RNI-like 8.5e-46
Family 28-residue LRR 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0X9R0
Sequence length 351
Comment (tr|H0X9R0|H0X9R0_OTOGA) Tropomodulin 2 {ECO:0000313|Ensembl:ENSOGAP00000012316} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TMOD2 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAA
TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE
EALASASDTELYDLAAVLGVHNLLNNPKFDEETSNNKGGKGPVRNVVKGEKVKPVFEEPP
NPTNVEMSLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVKKFSLAATRSND
PVAIAFADMLKVNKTLKSLNIESNFITGTGILALVDALKENDTLTEIKIDNQRQQLGTAV
EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
Download sequence
Identical sequences H0X9R0
ENSOGAP00000012316 XP_003784408.1.62490 ENSOGAP00000012316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]