SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XA45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XA45
Domain Number 1 Region: 101-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-27
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 4-33,73-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-18
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XA45
Sequence length 378
Comment (tr|H0XA45|H0XA45_OTOGA) Potassium channel subfamily K member {ECO:0000256|PIRNR:PIRNR038061} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KCNK9 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MKRQNVRTLSLIICTFTYLLVGAAVFDALESDHEMREEEKLKAEETRIRGKYNISTEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQSKGALQRKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNGDEEEQDLEGRAALPEGNGERPGGRGRRERRSARSRYKANIADLLSVCTC
SCYRPRDAGGDPPEEVEVPQNSNSAKPPNSLQPISFQMEEISPSTLKHGLFPSPISSVSP
GLHSFNDHNRLMRRRKSI
Download sequence
Identical sequences H0XA45
XP_003792904.1.62490 ENSOGAP00000012472 ENSOGAP00000012472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]