SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XA92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XA92
Domain Number 1 Region: 390-488
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XA92
Sequence length 489
Comment (tr|H0XA92|H0XA92_OTOGA) Macrophage receptor with collagenous structure {ECO:0000313|Ensembl:ENSOGAP00000012526} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=MARCO OC=Lorisiformes; Galagidae; Otolemur.
Sequence
PSAWCVSDAKPEKKHGVRCSIAVMFTYLILLTAGAGILVIQVLNLQERLQALEMHFPNGT
LATEHKPFFLLQWGRPSSHPGLQVLQAQLAQVRMSQEHLSQQVDNFTRNPELFGIKGERG
ATGPPGQKGAPGLPGTPGLPGPPAEKGAKGATGRDGATGPPGPQGPPGIKGEAGPHGPQG
TPGKQGAPGTPGPQGEKGSKGDGGLIGPKGAPGIKGDKGDLGLPGNKGDVGMKGDRGVMG
PPGAQGSKGDSGKPGPPGLLGSPGVKGDQGQPGAQGVPGLPGASGPPGAKGEPGSTGLRG
LTGLPGIPGSPGVSGMKGDKGNPGFQGQKGTKGEPGVPGLAGTKGERGQPGLAGPMGAPG
PAGQKGNPGLKGSPGLQGVKGEKGEKGESPVSVRIVGGSVRGRAEVYYNSTWGTICDDGW
DNLDATVFCRMLGYSRGRAITRQGAGTGQIWLDDVACQGTESTLWSCRKNSWGSHNCVHE
EDAGVECSI
Download sequence
Identical sequences H0XA92
ENSOGAP00000012526 ENSOGAP00000012526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]