SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XBX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XBX8
Domain Number 1 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000557
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 895-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000642
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000493
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 731-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000702
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 393-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000138
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 862-903
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000338
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 769-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000505
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  H0XBX8
Domain Number - Region: 300-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000498
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 344-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0184
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 435-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0398
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XBX8
Sequence length 1230
Comment (tr|H0XBX8|H0XBX8_OTOGA) Zinc finger and AT-hook domain containing {ECO:0000313|Ensembl:ENSOGAP00000013247} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ZFAT OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MCKCCNLFSPSQSELLSHVSEKHTEEGVNVDEIIIPLRPLSTPEPPTRSKAGDEFLVMKR
KRGRPKGSTKKASAEEELAENIVSPPEDCPLAAEEGSSLAPGSLECSKCCRKFSNTRQLR
KHICIIVLNLGEEEGEAGNESDLELEKKYREDDREKTPKRPRMQKTEKIQKIFPGKEAGQ
PSGAKKPIISVVLTAHEAIPGATKIVPVEAAPPETGAANPETTAADLVPRRGYQEYAIQQ
TPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIK
ANLNVHLRKHTGEKFACDCCSFTCLSKGHLKVHVERVHKKIKQHCRFCKKKYSDVKNLIK
HIRDAHDLQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDKWP
FACELCGHGATKYQALELHVRKHPFVYVCALCLKKFVSSIRLRSHIKEVHGAAQETLVFT
SSINQSFCLLEPGGDIQQEALGDQLQRAEEEFVFQRVNVLKEEARPGDAWPEEEQKKLEA
PVEIPTSAVHLASPQAKSAAPPPRELETTMISSELPSEAAVSDEFLLKNGSSSAEGNTAP
KKPSGSQHRGSDQTQGEVITVLLSKDQSAGPNQGTQGAESPPGEGQRMATLPESDPNLSR
CLRSNTAEASDLLPPVAGGGDIVTHRPDSCKPAPEHRPSMTAFMKVLDSLQKKQMNTGLC
ERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQK
HSNILLKCPTDGCDYSTPDKYKLQAHLKVHTALDKRSYSCPVCEKSFSEDRLIKSHIKTN
HPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCT
LCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCD
YTAAQKPQLLRHMEQHVSFKPFRCAHCPYSCNISGSLKRHYNRKHPDEEYANAGTGELAT
EVLIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEIDGDPKWETAVEAPEEPSTQYL
HIAEAEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGTETHDATALASVVA
MAPGTVTLVKQVTEEEPSSNHTVMIQETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQ
GGEASEFIVYVQEAVPPVEEQAVEQPAPEL
Download sequence
Identical sequences H0XBX8
ENSOGAP00000013247 ENSOGAP00000013247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]