SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XCG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XCG7
Domain Number 1 Region: 36-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000563
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XCG7
Sequence length 455
Comment (tr|H0XCG7|H0XCG7_OTOGA) F-box protein 47 {ECO:0000313|Ensembl:ENSOGAP00000013479} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO47 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MASRINTSFTLIPNQKRRRSNRRSCYFSNTLGSDSHPLSALGNFKALPLEIFQIILRYLS
VKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHKLELPGRRQDFTILEHYRSLGNL
CSKCLFLNIISCRGSVIKKVNTEKVSCFKFNGCATPLQCLGLPCYGMFLQQFGWGWWNVL
KCDLYFSFIICILTFLGRMVDSSFVLIGSARKLELRIRLFCRSVLLDHWTHRSDSAFWLT
RILKPWPMVNQARLLYIIFGPISSQDGQVVWQKMIEGPTDESSLKGLADAIKLLYDTGTK
EWTADDVISLVDELSVKVVPREWLLENNARLLILSGNNICFTFMASKAVNGRAIELARLI
VFLALVCEKELYCMNWAVKMMQKVCNVFSTPLERINFLQNVANAFACVTMEMLQSITSGD
HDEDDRSFLNLFHLVHAQANFHKEVLYLTMNTFST
Download sequence
Identical sequences H0XCG7
ENSOGAP00000013479 ENSOGAP00000013479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]