SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XCK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XCK3
Domain Number 1 Region: 828-1182
Classification Level Classification E-value
Superfamily RNI-like 1.96e-75
Family 28-residue LRR 0.0000075
Further Details:      
 
Domain Number 2 Region: 687-894
Classification Level Classification E-value
Superfamily RNI-like 1.96e-24
Family 28-residue LRR 0.0036
Further Details:      
 
Domain Number 3 Region: 59-149
Classification Level Classification E-value
Superfamily DEATH domain 3.65e-24
Family Pyrin domain, PYD 0.0071
Further Details:      
 
Domain Number 4 Region: 284-374,401-459
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000839
Family G proteins 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XCK3
Sequence length 1202
Comment (tr|H0XCK3|H0XCK3_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000013525} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
IKRGGGLNLLTGGSLLSNSTEHLIILPTGLIGCLLPKNPLFHQHLCFQRRIEMEEDDLSS
FSSYGLQWFLKELDKEELQAFKELLKEKSSESAICSVPQAEVDSADVERLAFLLHEYYTG
PQAWAMSLNIFEEMNLPTLLKKAKDAMKKHSLAEIPEDAEQTKIDQGPSQGGGSEISQAE
EQDDAVPTETKEQEISQATKQDGATAAETKEQGEEKHTDSFVATLAGSQEEKPVHAGDKW
TYKRHVMTKFSTKMSVYHGSERSASEWPEVQILASAFTPDQGGFQPLTVVLHGKSGIGKS
TLVRRIMLSWARGDLYQGTFSYVFLLHAREIEWRRESSFAELISREWPDSQAPVLEILSQ
PERLLFVLDSFDDMDSALKNGDPRLCEDWGTRQPTFILIRSLLRKVLLPKSSLIITVRDV
GLDKLKSVVVSPRYLLVGGISVEKRLQLLLEHIPDEHQKMQVLCLDNCELLDQCQVLTVC
SLIRKALELQKTVGGSSTPVCQTLTGLYATFMFHQLTPQEMSKPCLSREERAVLKSLCRM
AVEGVWDMKSVFDSDDLMVHGLREDELCALFHMDILPRDSHCEESYTFFHLSLQHFCAAL
YYVLEGLDREGICPLFIEKIKNLMELKQTGFNTHLLWMKRFLFGLMSRDVLQSLERLLAC
PIPVTVRQKLLHWVSLLGQQPGPTAPVDTLDSFHCLFETQDEEFVCLALNSFQEVWLPIN
QKMDLIVSSFCLQRCQHLQKIRVDVKEIFSREQTMWPGIPHWMQNKVFINEQWKNFCSVL
CTHPNLQQLDLGSSILNEWAMKALCAKLKHPTCKIQNLTFKNAQIMSGLQYLWMTLITNR
NIRHLNLGSTYLKDEDVKIACEALKHPNCLLESLRLDHCGLTHTCYLMISQILMSTSLKS
LGLAGNKVTDQGMKPLCDALKAPQCTLQKLMLENCSLSALSCQVLASALVGNRSLTHLCL
ANNCLGKEGVSLLSRSLRLPGCNLRRLILNHCGLDITGCGFLAFALMGNARLTHLSLSLN
PLEDDGMKLLCEAMREPSCQLQDLELVRCQLTATCCTDLSYVISRSKYLKSLDLAANTLG
DSGVMVLCEGLTQKKSLLTRLGLEACGLTSDCCEVLSSALSSNQRLTSINLVQNNFSPDG
MMKLCSAFACSMSNLQIIGLWKWQFPAQIQKLLQEVQLLKPHVIVDGNWYSFDKEDRYWW
KN
Download sequence
Identical sequences H0XCK3
ENSOGAP00000013525 ENSOGAP00000013525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]