SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XE75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XE75
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.01e-38
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 211-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000126
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 
Domain Number 7 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000838
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000249
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XE75
Sequence length 684
Comment (tr|H0XE75|H0XE75_OTOGA) Zinc finger protein 263 {ECO:0000313|Ensembl:ENSOGAP00000014230} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ZNF263 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MASGQSSQEQEGLLIVKLEEDCVWSQELPPSDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMHTKEQILELLVLEQFLIILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVVLEEPLPLETAQESPSFKLEPVETERSLGPRLQELLGPSPK
REPQAAKERALSAPWLSLFPPEGNIEDKEMTGPQLPESIEDVAVYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESHIPRQEIPTTQVEQERKPWDANVQSCKEGLSLRSPAQGKEKF
ENLEENSQSVSPENTHPQSLLPLQAGGEVPWSPDQGRPHDRAEGNWEPPPEGHLEQPLIG
ATNYRELGRPRELQPKKLHLCPLCGKNFSNNSNLIRHQKIHATERLYMGVECGEIFGGNP
HFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERT
HEKERLYSFSECGEAMNDSAPFFTNHRVHKTEKKVFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences H0XE75
ENSOGAP00000014230 XP_012661314.1.62490 ENSOGAP00000014230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]