SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XEF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XEF0
Domain Number 1 Region: 496-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.43e-110
Family PDEase 0.000000324
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 5.64e-32
Family GAF domain 0.00038
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 1.49e-29
Family GAF domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XEF0
Sequence length 859
Comment (tr|H0XEF0|H0XEF0_OTOGA) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PDE6A OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MGEVTAEEVEKFLDSNIAFAKQYYNARYRAKVISDLLGAKEAAVDFSTYHTPSSVEESEI
IFDLLRDFQENLQTEKCVFNVMKKLCFLLQADRMSLFMYRARNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGIVGHVAHSKKIANVPNTEEDEHFCDFVDILTEYQTKNILAS
PIMNGKDVVAIIMAVNKVEGPHFTKRDEEVLLKYLNFVNLVMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NASAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQDILKTREVYGKEPW
ECEEEELAEILQAELPDADKFEINKFHFSDLPLTELDLVKCGIQMYYELRVVDKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDENLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYETAQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYEAKMKALEEEKQKHQAAKQAAAGN
PGGNPNPGGAPASKSCCIQ
Download sequence
Identical sequences H0XEF0
ENSOGAP00000014320 ENSOGAP00000014320 XP_003782095.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]