SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XFK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XFK4
Domain Number 1 Region: 441-671
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-32
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XFK4
Sequence length 776
Comment (tr|H0XFK4|H0XFK4_OTOGA) Cation channel sperm associated 1 {ECO:0000313|Ensembl:ENSOGAP00000014799} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=CATSPER1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDQNLMSENTQNKADTDNLDMFSQHPSSSPRHSPGHRVAQHDGESRHHGTPHHHSGSHHS
PEFQDNTSSYYSYPSHHYSEVHHHGRTNSPTSSGPATSHGLVQSHDSYQKDSFNDEHYHD
SRMHHSGSHHQDGSYHHHSESPHHVGSHHGGSSHHIGSHHGGSPHHGGSSHHIGSHHSGS
PHHVGSHHSGSSHHIGSHHSGSPHHAGSHHGGSSHHIDFHHGRSHHHEAHHHRRPQHHGE
TASHISSEELYHHGHNEHHHGDYHPNEQHYGEHPHQRDHHHSEHAHQRIHQHHRDYSHYG
EHSSSLHPPDDLHGDHRYKEYHQSTSQLFVPHSLGKAPLSSTISSKPSHLSKGSTSTISQ
THSRVLSIGSQISNKVHPQDTASKDSESWDEEDEQFEKHKTGRSQRTHKKPRPPSFFTML
SEKLSYLIQGFRRMIWNLTHSWAFEIFIFFIICLNTVMLVAQTFAEVEIRGEWHFLALDC
IFFCIYVVEALLKIIALGLSYFRDYWNDLDFLIMIMAMLDFLLMQFNSSSSIYNQSLFRV
LKVCKSLRALRAIRVLRKFSILTSLQEVTGTLARSLPSITAILILMFTCLFLFSVVLRAL
FRKSDPKRFRSILTTIFTLFTMLTLDDWSLIYIDSRAQGAWYIIPILMIYIIIQYFIFLN
LVIAVLVDNFQMALLKGLEKVKQERAARIHEKILEDSITDLRKPEPEMVMSEGTMRKQFI
EKNFGPMTDKQQELLFHYLQLVAAVENQQQKFRSQASVANEIVDATFEVGEEDFKR
Download sequence
Identical sequences H0XFK4
ENSOGAP00000014799 ENSOGAP00000014799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]