SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XGC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XGC1
Domain Number 1 Region: 679-948
Classification Level Classification E-value
Superfamily VPS9 domain 4.18e-46
Family VPS9 domain 0.0056
Further Details:      
 
Domain Number 2 Region: 431-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.68e-25
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 356-446
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 5.62e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.015
Further Details:      
 
Domain Number 4 Region: 13-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000206
Family DBL homology domain (DH-domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XGC1
Sequence length 953
Comment (tr|H0XGC1|H0XGC1_OTOGA) ALS2 C-terminal like {ECO:0000313|Ensembl:ENSOGAP00000015118} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ALS2CL OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MCSPQEAALLRLEEVFSATLARVNSLVFQPLLSAAPEPSEPQSRECLRLLQQLHRSSQQL
WEVTEESLHSLRERLRHPDSTGLESLLLLRATDHVLQLHIEYIESYTSCLVVQAFQKLAK
RRSEYWRGQRKALRQLLGGMGSEGSVGPALLQAFRQPLTHHVQQYVLLLLRLEDTVPEYH
PARELVVNAATLFGNLQSFMSQALDQAMATQALWHTLSSRQRHVLCTPAHRLLQDSEDVP
VTVTPLRAERVMLFDDALILLQGHNIHTFDLKLVWVNPGQDRCTFHLLTPEEELSFRTKD
PQGQAVWQWKVTQAVCQALRGKKDFPVLGAGLEASEPPACRCGAYTFHAEGRFCQATYEG
EWCQGRPHGKGTLKWPDGQNHVGDFRQGLEHGFGIRLLPQASEDRFDCYKCHWREGSMSG
YGICEYGTDEVYKGYFQEGLRHGFGVFESALQAARPFRYTGHWEKGQRSGYGIEEDSDRG
ERYIGMWQADQRHGPGVVVTQAGVCYQGTFHADKMVGPGILLSEDDSLYEGTFTKDLTLM
GKGKVTFPNGFTLEGSFGSGAGRGLHTQGVLDTAALPLDPSSTCKRQLGLGAFPVESRWQ
GVYAPFRDFVGAGCPGDLQEALLGFQVQSSRELRKSQDYLCCERTCPEDSVGTIEDILEE
LLQHREPKALQEHLRKALSNTLHPLGKLLQTLMRTFQATYAGVGANKHLQELAQEEVKQH
AQELWATYRGLLHVALQRKGQAPEEDEDAETRDLQVHGLMLPLVLPSFYSELFTLYLLLH
EREDSLYSQGITNLSLFPDTKLLEFLEVQKHLWPLKDLTLTTNQRYSLVRDKCFLSATEC
LQKIMTTVDPREKLEVLERTYGEIEATVSRVLGQEHKLPMDDLLPLLIYVVSRARIQHLG
AEIHLIRDMMNPIHIGGLYDFLLTALESCYEHLQKEDMRLHHFPGHWDSRELW
Download sequence
Identical sequences H0XGC1
XP_003794574.1.62490 ENSOGAP00000015118 ENSOGAP00000015118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]