SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XGG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XGG0
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000000458
Family F-box domain 0.005
Further Details:      
 
Domain Number 2 Region: 84-397
Classification Level Classification E-value
Superfamily RNI-like 0.00000000471
Family 28-residue LRR 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XGG0
Sequence length 443
Comment (tr|H0XGG0|H0XGG0_OTOGA) F-box protein 39 {ECO:0000313|Ensembl:ENSOGAP00000015166} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO39 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDEESELIQPQDQSCWATLPDVCLRRVFWWLGDRDRSRAALVCRKWNQMMYSADLWRYRT
ITFSGRPSRVHASEFESALWYVKKFGRYLEHLEIKFLNPYNTVLTKKFQVTMRGLLSCLG
RSNSRLKSLSIQHLELDRLVWRNSIRSSFIKSLSFFLKKMGKHLDYLNLKGARLTVEQGC
HILNSLSYQRNESLVSELNIEDYFSHHLAVYSSPQFHKTMGTFHNLTALTLNYNCISDEL
LENLCENNASTLWTINIKCHIHDPHGQVIWGMSWAKLARQATNLKVNFFFERVMKYERLA
RILLQEIPVRSISLRSCYFSDPDWSMRPTLTDLLPTFRHTLQKLTFEFNNNHESLDEELH
LLILSCRKLFYFKIWAFLDVKFVERILKSQEEGQCSLRTLKVRIYTNRYETNEEDRTLRD
IYRKYRKLIDSELNYFVIAYPMM
Download sequence
Identical sequences H0XGG0
XP_003799087.1.62490 ENSOGAP00000015166 ENSOGAP00000015166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]