SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XGP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XGP6
Domain Number 1 Region: 272-430
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.17e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000172
Further Details:      
 
Domain Number 2 Region: 110-269
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.18e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000753
Further Details:      
 
Domain Number 3 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000925
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 4 Region: 66-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XGP6
Sequence length 430
Comment (tr|H0XGP6|H0XGP6_OTOGA) Milk fat globule-EGF factor 8 protein {ECO:0000313|Ensembl:ENSOGAP00000015261} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=MFGE8 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MPGSRLLAALCCALLCASGLRAAPGDLCDSSPCLNGGTCMVGRDNASFHCFCLEGFTGLI
CNETEKNPCSPNPCHNGGECRVTGNERRGDVFTPYACICTQGYVGTHCDDRCATPVGMEG
GAIADSQISASSVHLGFMGLQRWGPELARLHRTGIVNAWTASNYDKNPWIQVNLLRKMWV
TGVVTQGASRAGTHEYLKTFKVAYSLDGHRFTVIQDTETLGDKVFMGNVDNNGLKYNLFK
TPVEAQYVRLLPVLCQRACTLRFELLGCELNGCSEPLGLKDNIILDKQVKASSTYKTWGV
QAFSWYPFYARLDYQGKFNAWTAASNNASEWLQVDLGSQREVTGIITQGARDFGSIQYVA
SYKVAYSNDGMTWTEYKDPRTDKSKIFPGNSDNNSHKKNVFETPILARFVRILPVAWHNR
ITLRLELLGC
Download sequence
Identical sequences H0XGP6
ENSOGAP00000015261 ENSOGAP00000015261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]