SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XGV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XGV1
Domain Number 1 Region: 31-378
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.09e-78
Family (Glycosyl)asparaginase 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XGV1
Sequence length 407
Comment (tr|H0XGV1|H0XGV1_OTOGA) Taspase 1 {ECO:0000313|Ensembl:ENSOGAP00000015319} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TASP1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MTMEKGMSSGEGLPSRSSQEKQSHKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKA
IEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGA
LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAHRWAVDHGIPSCPPNIMTTRFS
LAAFKRNKRKLELAERVETDFIQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSS
GGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRTILARECSHALQA
EDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSEADSSQNKQTLLVEFLWSHT
TESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN
Download sequence
Identical sequences H0XGV1
ENSOGAP00000015319 XP_003788055.1.62490 ENSOGAP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]