SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XH54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XH54
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000036
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Domain Number 2 Region: 568-614
Classification Level Classification E-value
Superfamily F-box domain 0.00000235
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XH54
Sequence length 707
Comment (tr|H0XH54|H0XH54_OTOGA) F-box protein 40 {ECO:0000313|Ensembl:ENSOGAP00000015442} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO40 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
CPWFVQGRARRPPPEQHRHCEGCFNRHCHAPVEPKISCLVISCHLLCGATFHMCKEAEHE
LLCPLEQVPCLNSQYGCPLSMSRHKLAKHLQACPASVVCCSMEWNRWPNVDSETTLHENI
MKEPPSEECLDTALALQDQKVLFRSLKMVELFPETREAAEEEPDVNGEASLEDMGGAVGG
VGAGLVPHSCLPATNGDAAELTQEEREALAKTKEGMDLHKFGQWENMFSKEHAASALANS
SGSCESKSRNGPGEEQISRGNVAKGEGTANGKEPQDLHTVMETTGLAPWQDGVLERLKTA
VDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVHTFRVPVSYCGKRA
RIGDAMLSCRPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSIDG
LFVDFATQTYNFEAEQFSAGTVLADLTTASPRGLHVELHSECVTRRHNKSSSAFTFTCNK
FFRRDEFPLHFKNVHTDIQSCINGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELK
TFAIKPEVAPELSEGKKNKHLSGHRGKSQNGLTSLPLEILQYIAGFLDSISLSQLSQVSV
LMRNICATLLQERGMVLLQWKKKRYSHGRSSWRVHREIWQFSSLFSKIKSWEFNEVTSMS
EHLKACPFNIVEHKTDPVLLTSMCQPREQAPESLVSTFRARARGRYA
Download sequence
Identical sequences H0XH54
ENSOGAP00000015442 ENSOGAP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]