SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XHL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XHL7
Domain Number 1 Region: 557-622
Classification Level Classification E-value
Superfamily F-box domain 0.0000000981
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XHL7
Sequence length 693
Comment (tr|H0XHL7|H0XHL7_OTOGA) F-box protein 34 {ECO:0000313|Ensembl:ENSOGAP00000015607} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO34 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MHLKLYWRHQKRERPLEVNRRTLRLPMSHQKALSDEKWKASLMKPLVSLGKAPSQKPLGI
LSPDVLCSMSGKNPVESSLNIKTRKNVPSTTIHQGEEGALDIWAVVKPGNTKEKIAFFAA
HQCNTRTGSMKIKSSWDIDGRATKRRKKSGDLIKAKLQLESMREVSSRCHQPEPFACGIK
HCSVHYVSDSGDGVYTGRPLSVIQMVAFLEQRASALLASCAKNCTNSPAVVRFPGQSRGA
PPASEHFSAPGACEPIERGNPEVGEPQSEPVRVLDIVARLESECLRQQSQHELGSLSRNN
SFHRSAGGVLLSNSTQADEGKTGKGAVEAPATQVDPTGSASVACVPSGAGHSPNGDKTWD
GTSQGHLSLRAGVSFHMDDTELEPSLQITMKNSNRTDVEMTDELVRLPFPSHVCPQAAEL
PTDAVDCMNRALVPLTSPSLDQRRKVSLCVGIPMSKVEKDQPSSLDACEDPLPGMLFFLP
PGQHSDCSQLSESTRKVASESSQLAVSDSTSEPLVPPPSSVESASPVLEASSWKKQVSHD
FLETRFKIQQLLEPQQYMVFLPHHIMVKIFRLLPTKSLVALKCTCYYFKFIIEHYNIRPS
DSRWVRDPRYREDPCKQCKKKYVRGDVSLCRWHPKPYCQAFPYGPGYWMCCHRSQKAFPG
CQLGLHDNRWVPACHSFNREIHKKSKGTETEEE
Download sequence
Identical sequences H0XHL7
XP_003794442.1.62490 ENSOGAP00000015607 ENSOGAP00000015607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]