SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XHV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XHV1
Domain Number 1 Region: 78-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-44
Family Regulator of G-protein signaling, RGS 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XHV1
Sequence length 217
Comment (tr|H0XHV1|H0XHV1_OTOGA) Regulator of G protein signaling 19 {ECO:0000313|Ensembl:ENSOGAP00000015691} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=RGS19 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MPTPHEAEKQHTGPEEADRPPSMTSHDVAPQVAPGRNPCCLCWCCCCSCSWNEERRRVWQ
ASRESKLQPLPGCEVCATPSHEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEDLKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLRGASQSSSES
Download sequence
Identical sequences H0XHV1
XP_003787844.1.62490 ENSOGAP00000015691 ENSOGAP00000015691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]