SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XKR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XKR7
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XKR7
Sequence length 160
Comment (tr|H0XKR7|H0XKR7_OTOGA) Neuronal calcium sensor 1 {ECO:0000313|Ensembl:ENSOGAP00000016707} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=NCS1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
ENSCAFP00000029561 ENSCAFP00000029561 ENSSSCP00000006105 ENSPVAP00000003345 ENSOGAP00000016707 ENSSSCP00000006105 ENSMGAP00000005178 ENSOGAP00000016707 ENSBTAP00000011496 ENSCJAP00000037900 XP_010135997.1.100080 ENSPVAP00000003345 ENSBTAP00000011496 9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSMGAP00000005178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]