SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XLM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XLM1
Domain Number 1 Region: 467-584
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000785
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XLM1
Sequence length 601
Comment (tr|H0XLM1|H0XLM1_OTOGA) F-box protein 46 {ECO:0000313|Ensembl:ENSOGAP00000017011} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO46 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDRSSLLPFQLWCPRPFGTYSQNQPRAPSATLKPSACPEPGSGAEPDHGPVHSENTPPAL
ATEVPTSQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKV
KGHWGSDSSKAKRRRRCLEPTKAPPDPGGREGPLAPEEGPASVGEDLLSVAEMVALVEQR
AALALQSYPRPPTPAPVVFVSAEQGGPAKGLGSERRSGGGDCSRVAEAVAHFEAQRDNTP
TKGLRKEERPGPGPGEVRIAFRISNGRESRAPEGSLPNGAGGRPGCAYPGSPGPGARAKD
KITCDLYQLISPSRDALPSNVEFLLARADEASEGESPAPARPEDTPPAPPPPPARDCGAS
GFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQSRGPDGPPEP
PPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLV
KIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDV
SLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEG
R
Download sequence
Identical sequences H0XLM1
ENSOGAP00000017011 ENSOGAP00000017011 XP_003799568.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]