SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XM16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XM16
Domain Number 1 Region: 71-206
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.84e-31
Family Nuclease 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XM16
Sequence length 223
Comment (tr|H0XM16|H0XM16_OTOGA) Phospholipase D family member 6 {ECO:0000313|Ensembl:ENSOGAP00000017156} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PLD6 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MRRLGWPAMAVAAVGLALALEALPWVLRRLRTGRRRPRREVLFFPSQVTCTEALLQAPGA
LAGSATACPCSLPHGESSLSRLLRALLAARASLELCLFAFSSPQLGRAVQLLHQRGVRVR
AITDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKKVLITGSLNWTTQAIQN
NRENVLIMEDEEYVRLFLEEFERIWEEFNPTKYTFFPQKKRSH
Download sequence
Identical sequences H0XM16
ENSOGAP00000017156 XP_003800768.1.62490 ENSOGAP00000017156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]