SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XML2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XML2
Domain Number 1 Region: 82-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 2 Region: 49-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000654
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XML2
Sequence length 273
Comment (tr|H0XML2|H0XML2_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000017353} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
VPVLSLALVLDAMAWEQGPPGVISPWRGCAELGRCCPDRDPMCFARGPPRCFCDEACGAA
RDCCADYTRVCPADYTRVCPAVSCVVAEWSGWSRCVKPCQVSYRVRQRHVLQEPRNGGIP
CPPLEERAGCVEYWSCQGVECQQSLLPALITTGSYGKEREKSERSQQQWRRTELLTYCIQ
FRLGFIPGSCGQVKARHAQWTRYLSQGHMVCVKCEWPAQDARSQRCYGDGGGARGNKLLL
WQAAGHPRCQGTWERLGPLRDCSCPTVHSFVFI
Download sequence
Identical sequences H0XML2
ENSOGAP00000017353 ENSOGAP00000017353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]