SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XR50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XR50
Domain Number 1 Region: 188-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-54
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 7.46e-33
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XR50
Sequence length 490
Comment (tr|H0XR50|H0XR50_OTOGA) Potassium voltage-gated channel modifier subfamily S member 3 {ECO:0000313|Ensembl:ENSOGAP00000018592} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KCNS3 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MVFGEFFHHPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCRSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEESHEKDWDQKSHDASTDSSFEESSLFEKELEKFDKKRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCIHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEDESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDPPEKCHELPYFNIRDIYAQRVHAFISSLSSVGIVVSEPDSTDASSIEDKDVPH
ATSLENCTAK
Download sequence
Identical sequences H0XR50
XP_003787459.1.62490 XP_012659185.1.62490 ENSOGAP00000018592 ENSOGAP00000018592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]