SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XSC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XSC5
Domain Number 1 Region: 226-471
Classification Level Classification E-value
Superfamily RNI-like 3.4e-44
Family 28-residue LRR 0.011
Further Details:      
 
Weak hits

Sequence:  H0XSC5
Domain Number - Region: 90-155
Classification Level Classification E-value
Superfamily F-box domain 0.000589
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XSC5
Sequence length 497
Comment (tr|H0XSC5|H0XSC5_OTOGA) T-complex-associated-testis-expressed 1 {ECO:0000313|Ensembl:ENSOGAP00000019017} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TCTE1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MQDTVTTPQPSAVSRPSLSTQDKTSTGITGSQPWKPMVTPASVKSKPPTSGNSFYRMRRI
IAEDPEWSLAIVPLLTELCIQHIVRNFQNNPILKQLLPEHQQKVLSRLSPDLPLTVTANL
IDDEGYWRRCCTQRWPVCYVAQHGGSWKHMFFERHLENLLKHFIPGTTDPAVILDMVPLC
RNYVRRLHVDQFLPPVRLPSPPRAVDQSDSGSEGEVEESTTDHYQLGDLVAGLSYLEELD
LVYGVKDCGMNFEWNLFLFTYRDCHSLAATIKACLTLKIFRLTRSKVDDDKARILIRSLL
DHPVLEELDLSHNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPGAQSLAHALAHNTSL
ISLNLRLNCIEDEGGQALAHALHTNKCLTTLHLGGNELSEPTATLLAQVLSTNTTLTSIN
LSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALNANREAARQRALNP
IQFMSPITADGPENSAG
Download sequence
Identical sequences H0XSC5
ENSOGAP00000019017 ENSOGAP00000019017 XP_003789280.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]