SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XUD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XUD4
Domain Number 1 Region: 62-191
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-47
Family Regulator of G-protein signaling, RGS 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XUD4
Sequence length 197
Comment (tr|H0XUD4|H0XUD4_OTOGA) Regulator of G protein signaling 8 {ECO:0000313|Ensembl:ENSOGAP00000019726} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=RGS8 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKNMLRFRTFTATELQGSR
RLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVS
KAHRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFL
RSKMYLDLLSQSQRRLS
Download sequence
Identical sequences H0XUD4
ENSOGAP00000019726 ENSOGAP00000019726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]