SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XVB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XVB5
Domain Number 1 Region: 79-160
Classification Level Classification E-value
Superfamily F-box domain 1.7e-20
Family F-box domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0XVB5
Sequence length 309
Comment (tr|H0XVB5|H0XVB5_OTOGA) F-box protein 16 {ECO:0000313|Ensembl:ENSOGAP00000020057} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO16 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MMAFAPPKSIDGPKMQTKMSTWTPLNHQLLNDQIFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCQKLQEKLPAESLDFTTKLPRVLSVYIFSFLDPRSLCRCAQVCWHWK
NLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHVTKPKTPPKDEFVIAD
VQPVTSSSPKEKQSPLSAFQSYSSLRRKSKAEKKELPPWRSSDKHPTDIIRFNYLDNCDP
LDSVWHGRKKRNEMTPDFSRQPHEKRNKLQDRSRLRKAQSLVSVTHKRFTTVMLMTITRS
PILFEKLVA
Download sequence
Identical sequences H0XVB5
ENSOGAP00000020057 ENSOGAP00000020057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]