SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XVQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XVQ5
Domain Number 1 Region: 678-944
Classification Level Classification E-value
Superfamily RNI-like 1.16e-60
Family 28-residue LRR 0.0037
Further Details:      
 
Domain Number 2 Region: 17-105
Classification Level Classification E-value
Superfamily DEATH domain 1.08e-17
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Weak hits

Sequence:  H0XVQ5
Domain Number - Region: 157-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000875
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XVQ5
Sequence length 953
Comment (tr|H0XVQ5|H0XVQ5_OTOGA) Nucleotide binding oligomerization domain containing 1 {ECO:0000313|Ensembl:ENSOGAP00000020198} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=NOD1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEKQGHSEMETIPSDSPSYIKLLKTHRELLVTHIRNTQCLVDNLLKNDYFSAEDSEIVCA
CPTQPNKVRKILDLVQSKGEEVSEFFLYVLQQLTDAYVDLRPWLSQISFSPSQLIQSKIV
LNTDPVSRYTQQLRHHLGRDSKFTLCYGQKEEVLLEEMYMDTVMELVDFNNERLGSLDSL
ACLLDHATGVLDAQGETVFVCGDAGVGKSMVLQRLQNLWATSQLDTGVKFFFHFRCRMFS
CFKESDTLCLQDLLFKHYCYPEQDPDEVFSFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKVLTARTGVEVPRQLLRKKVLLRGFSPSHLRSY
ARRMFPERAMQDLLMTQLEANPNLCSLCAVPLFCWIIFQCFRHFHTAFEGSAQLPDCTVT
LTDIFLLVTEVHLNRTQPSSLLQRNTRSQVETFRAGRDTLRALGQVAHWGMEKGLFVFSQ
EEAQTSQLREEDLQLGFLRALPEPGPGGHQQSFEFFHLTLQAFFTAFFLVVDDKVGTRQL
LHFFQEWAPPGEPVATSCYPPLFPFQCLGGGGLAGGDPFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPVAALRRKRKALWAHLFSRLRSYLKSLPRVQTEVFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAAKGICANYLKLTYCNACSADCSALSFVLHHIRSQLALDLDNNNLNDYGV
QQLQPCFSRLTVIRLSVNQITDSGVKVLYEELTKYRIVTYLGLYNNQITDVGARYVSKIL
DECKGLMYLKLGKNKITSEGGKCLALAVKNSKSIFDIGMWGNQIGDEGAKAFAEALRNHP
SLTNLSLAFNGISTEGGKSLARALQQNTCLRIFWLTKNELNDEVAESMAEMLKVNQTLKH
LWLIQNQITARGLARLADALQNNTGIMEICLHGNPIKPEEAKVFEDENRLICF
Download sequence
Identical sequences H0XVQ5
ENSOGAP00000020198 XP_003788597.1.62490 ENSOGAP00000020198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]