SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XWE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XWE1
Domain Number 1 Region: 77-263
Classification Level Classification E-value
Superfamily RNI-like 8.63e-34
Family Cyclin A/CDK2-associated p19, Skp2 0.0088
Further Details:      
 
Domain Number 2 Region: 17-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000196
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XWE1
Sequence length 298
Comment (tr|H0XWE1|H0XWE1_OTOGA) F-box and leucine rich repeat protein 15 {ECO:0000313|Ensembl:ENSOGAP00000020434} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXL15 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
LPGNSDLRRQRSFTRRLLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRGFRALVQLHLAGL
RRFDAAQVGPQIPRAAFSWLLRDAEGLQELALAPCHEWLLDEDLVPVLARNPQLRSVALA
GCVQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLVDRCPALEELDLTACRQLKDE
AIVYLAQRLGASLRSLSLAVNANVGDTAVQELARNCPELEHLDLTGCLRVGSDGVRTLAE
YCPALRSLRVRHCHHVAEPSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences H0XWE1
ENSOGAP00000020434 ENSOGAP00000020434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]