SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XWG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XWG6
Domain Number 1 Region: 53-283
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.34e-71
Family Ecto-ART 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0XWG6
Sequence length 314
Comment (tr|H0XWG6|H0XWG6_OTOGA) Mono(ADP-ribosyl)transferase {ECO:0000256|RuleBase:RU361228} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ART4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
PLINRCKRILFPATAATAASAREIQLLRGPLRLLLLLCALQKPTQSSENATKINFDLAPG
SFDDQYHGCSKQVMEKLNQGDYFTKDLQDHKNYSRIWHKTHLTWMNQPQTLPKNMTIPHA
VALLVYTLNSNVRSDFCKALANDAKTPQQYEHSFYFKYLHYYLTTAIQLLRKEVTRENDR
LCYQVHHEAKGVPFKAYVGATVRFGQFLSTSLLKEEARKFENQTLFTIFTCLGASVQDFS
LRKEVLIPPYELFKVVNMSYHPRGNWLQLQSTGNWSTYNCQLLKASNKKCTPAPTVITSV
SFLTTIIISFISGV
Download sequence
Identical sequences H0XWG6
ENSOGAP00000020459 ENSOGAP00000020459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]