SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0XXK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0XXK3
Domain Number 1 Region: 29-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0061
Further Details:      
 
Weak hits

Sequence:  H0XXK3
Domain Number - Region: 304-386
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00455
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0XXK3
Sequence length 404
Comment (tr|H0XXK3|H0XXK3_OTOGA) F-box protein 22 {ECO:0000313|Ensembl:ENSOGAP00000020846} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO22 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEPVGGGGDRCGSSSADPRSTFVLSNLAEVVERVLTFLPAKALLRVAGVCRLWRECVRRV
LRTHRSVTWISAGLAEAGHLEGHCLVRVAAEELENVRILPHTVLYMADSETFINLEECRG
HKRARKRTSMETAFALEKLFPKQCQILGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLF
PQIEGIKIQPFHFTKDPKKLTIERHQLTEVGLIDNPELRVVLIFGYNCCKMGASNYLHRV
VSSFSDMNIILAGGQVDNLSSLTSQKNPVDLDATGVVGLSFSGLRIQSATVLLNEDVTDE
KSAEAAMQRLKAANIPEQNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFG
NGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Download sequence
Identical sequences H0XXK3
ENSOGAP00000020846 XP_003784598.1.62490 ENSOGAP00000020846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]