SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Y0K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y0K8
Domain Number 1 Region: 384-629
Classification Level Classification E-value
Superfamily RNI-like 2.22e-27
Family 28-residue LRR 0.0037
Further Details:      
 
Domain Number 2 Region: 130-217,246-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000706
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 
Weak hits

Sequence:  H0Y0K8
Domain Number - Region: 63-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00084
Family Nucleotide and nucleoside kinases 0.048
Further Details:      
 
Domain Number - Region: 330-409
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.051
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Y0K8
Sequence length 629
Comment (tr|H0Y0K8|H0Y0K8_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000021901} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
PRLEVEEANGKELADVLIDRSPQILDRGVVNSSEKMNLTDLSKMAKGQIPGSAQGQGKMA
ELEDTDTEDDLDVEMSGKKEECRNITEILPLLRKNKFQLVGSDNFLASVIQRSQKFIPFL
QPRIAPQPIAHTVVLYGPAGVGKSTLAKQVFLDWAENNLNQMFNYVFYLRCKELNHVGAC
SFAELIFKDWPEWLGCAAEVFGQAQKILFIIDGFEELRVPAGALIHDICGNWEREMPVPV
LLGSLLKRKMLPKASLLVTTRPEALRELRLLVEQPLFIEMEGLLEPDRRAYFLRQFADQD
QALRALDLMKGNVVQKLFSKEERVRNPSLTQVGYFLFGLSNEKRVQELESTFGCRMSLQI
REELLKYRANLDENKPFSRTDMKELLYCLYESQDEGLMRDAMVPFTEVSLHWMNTFEVMY
SSFCLKHCQNLQKLSLQIARGIFLENDPVSREDAQLESWSRCDHRSLCVWMDFCSVVSSN
KNLRVLDMTQSFLSDSSVRILCDHITRFSCHLQKVVIRNVTPDSAYRDFCLAFVGKKTLT
HLTLEGHVQWDDMLLLLLGEVLKHVKCSLQYLRLGFHSVTTERWTNLTLALKVNQSLMCL
DLSDNELLDESAKLLYTSLKGPKCLLQRL
Download sequence
Identical sequences H0Y0K8
ENSOGAP00000021901 ENSOGAP00000021901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]