SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Y2K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y2K8
Domain Number 1 Region: 27-248
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.7e-61
Family Proteasome subunits 0.000000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0Y2K8
Sequence length 300
Comment (tr|H0Y2K8|H0Y2K8_OTOGA) Proteasome subunit beta type {ECO:0000256|RuleBase:RU004203} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PSMB11 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MALQDVCKWQVPDTQRLSPHLPQSAGWAMPRGCDPQAFLQMRGPRLAHGTTTLAFRFQHG
VIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRALREG
QLPSVASAAKLLSAMMSRYRGLDLCVATALCGWDCSGPALFYVYSDGTRLQGDIFSVGSG
SPYAYGVLDRGYRYDMTTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRND
ACVLYKELQELREPALEEEACQAHPEPATTHISGEDGELSAGAREVTPGDSKMPAGTEVL
Download sequence
Identical sequences H0Y2K8
ENSOGAP00000022601 ENSOGAP00000022601 XP_003801968.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]