SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Y4G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y4G9
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 2 Region: 172-314
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-26
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Y4G9
Sequence length 316
Comment (tr|H0Y4G9|H0Y4G9_HUMAN) Myeloid differentiation primary response protein MyD88 {ECO:0000313|Ensembl:ENSP00000391753} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MYD88 OC=Catarrhini; Hominidae; Homo.
Sequence
RPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWT
ALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPS
IEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYC
PSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRMV
VVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC
TKSWFWTRLAKALSLP
Download sequence
Identical sequences H0Y4G9
ENSP00000391753 ENSP00000391753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]