SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Y5R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y5R1
Domain Number 1 Region: 322-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.63e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 60-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.67e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 143-197,225-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000074
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0Y5R1
Sequence length 588
Comment (tr|H0Y5R1|H0Y5R1_HUMAN) Aryl hydrocarbon receptor nuclear translocator-like protein 2 {ECO:0000313|Ensembl:ENSP00000400185} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARNTL2 OC=Catarrhini; Hominidae; Homo.
Sequence
XPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPSHQNPLTYLLSTRIEISASSGS
REAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYV
GSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSLF
DFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRRSFFCRIKS
CKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVA
IGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYF
HQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSV
NTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQ
RLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQNQSTVAVHSHE
PLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences H0Y5R1
ENSP00000400185 ENSP00000400185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]