SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0Y9D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y9D2
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.91e-17
Family SepSecS-like 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0Y9D2
Sequence length 95
Comment (tr|H0Y9D2|H0Y9D2_HUMAN) O-phosphoseryl-tRNA(Sec) selenium transferase {ECO:0000313|Ensembl:ENSP00000423850} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SEPSECS OC=Catarrhini; Hominidae; Homo.
Sequence
XKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIH
STTSCFAPRVPDRKSFSFTFFRCPYYFIVTWIKWL
Download sequence
Identical sequences H0Y9D2
ENSP00000423850 ENSP00000423850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]