SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YAH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YAH1
Domain Number 1 Region: 2-35
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000249
Family HLH, helix-loop-helix DNA-binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0YAH1
Sequence length 92
Comment (tr|H0YAH1|H0YAH1_HUMAN) Heart- and neural crest derivatives-expressed protein 2 {ECO:0000313|Ensembl:ENSP00000427084} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HAND2 OC=Catarrhini; Hominidae; Homo.
Sequence
XPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKEL
NEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences H0YAH1
ENSP00000427084 ENSP00000427084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]