SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0YD59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0YD59
Domain Number 1 Region: 59-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0YD59
Sequence length 165
Comment (tr|H0YD59|H0YD59_HUMAN) Upstream stimulatory factor 1 {ECO:0000313|Ensembl:ENSP00000433041} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=USF1 OC=Catarrhini; Hominidae; Homo.
Sequence
XSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPR
TTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQVGFYPKLVIISRSFG
RVTTACLKNCRDLTNCSWTMTCFDNRWKILKTRICCFELSCGTTD
Download sequence
Identical sequences H0YD59
ENSP00000433041 ENSP00000433041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]